Showing Protein Prostaglandin E synthase 3 (BMDBP00551)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP00551 |
| Secondary Accession Numbers | None |
| Name | Prostaglandin E synthase 3 |
| Synonyms | Not Available |
| Gene Name | PTGES3 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in prostaglandin-E synthase activity |
| Specific Function | Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway. |
| Pathways |
|
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 5 |
| Locus | Not Available |
| SNPs | PTGES3 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 160 |
| Molecular Weight | 18697.0 |
| Theoretical pI | 4.11 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Prostaglandin E synthase 3 MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID PNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF DRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE |
| External Links | |
| GenBank ID Protein | AAU04847.1 |
| UniProtKB/Swiss-Prot ID | Q3ZBF7 |
| UniProtKB/Swiss-Prot Entry Name | TEBP_BOVIN |
| PDB IDs | |
| GenBank Gene ID | AY692440 |
| GeneCard ID | PTGES3 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |