| Identification |
| BMDB Protein ID
| BMDBP00649 |
| Secondary Accession Numbers
| None |
| Name
| Serine/threonine-protein phosphatase PP1-gamma catalytic subunit |
| Synonyms
|
Not Available
|
| Gene Name
| PPP1CC |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Signal transduction mechanisms |
| Specific Function
| Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Dephosphorylates RPS6KB1. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E (By similarity). |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
Not Available
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 17 |
| Locus
| Not Available |
| SNPs
| PPP1CC |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| 323 |
| Molecular Weight
| 36984.0 |
| Theoretical pI
| 6.5 |
| Pfam Domain Function
|
Not Available |
| Signals
|
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
|
| External Links |
| GenBank ID Protein
| CAD22157.1 |
| UniProtKB/Swiss-Prot ID
| P61287 |
| UniProtKB/Swiss-Prot Entry Name
| PP1G_BOVIN |
| PDB IDs
|
|
| GenBank Gene ID
| AJ429235 |
| GeneCard ID
| PPP1CC |
| GenAtlas ID
| Not Available |
| HGNC ID
| Not Available |
| References |
| General References
| Not Available |