| Identification |
|---|
| BMDB Protein ID
| BMDBP00794 |
| Secondary Accession Numbers
| None |
| Name
| Methionine aminopeptidase |
| Synonyms
|
Not Available
|
| Gene Name
| Not Available |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Translation, ribosomal structure and biogenesis |
| Specific Function
| Cotranslationally removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
Not Available
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| Not Available |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| 189 |
| Molecular Weight
| 20645.0 |
| Theoretical pI
| 5.59 |
| Pfam Domain Function
|
Not Available |
| Signals
|
|
|
Transmembrane Regions
|
- 6-31
- 67-86
- 98-117
- 137-158
- 164-184
- 196-222
|
| Protein Sequence
|
>Methionine aminopeptidase
KLEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISG
RIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDGK
TYQVKPIRNLNGHSIGPYRIHAGKTVPIVKGGEATRMEEGEVYAIETFGSTGKGVVHDDM
ECSHYMNKF
|
| External Links |
|---|
| GenBank ID Protein
| BAC56465.1 |
| UniProtKB/Swiss-Prot ID
| Q862K9 |
| UniProtKB/Swiss-Prot Entry Name
| Q862K9_BOVIN |
| PDB IDs
|
|
| GenBank Gene ID
| AB098975 |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| Not Available |
| References |
|---|
| General References
| Not Available |
