Showing Protein Glyceraldehyde-3-phosphate dehydrogenase (BMDBP01095)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01095 |
| Secondary Accession Numbers | None |
| Name | Glyceraldehyde-3-phosphate dehydrogenase |
| Synonyms | Not Available |
| Gene Name | Not Available |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Carbohydrate transport and metabolism |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 5 |
| Locus | Not Available |
| SNPs | Not Available |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 40 |
| Molecular Weight | 4336.0 |
| Theoretical pI | 6.62 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Glyceraldehyde-3-phosphate dehydrogenase FNGTVKAENGKLVINGKAITIFQERDPANIKWGDAGAEYV |
| External Links | |
| GenBank ID Protein | AAZ32293.1 |
| UniProtKB/Swiss-Prot ID | Q2QJG6 |
| UniProtKB/Swiss-Prot Entry Name | Q2QJG6_BOVIN |
| PDB IDs | |
| GenBank Gene ID | DQ066892 |
| GeneCard ID | Not Available |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |