Identification
BMDB Protein ID BMDBP01095
Secondary Accession Numbers None
Name Glyceraldehyde-3-phosphate dehydrogenase
Synonyms Not Available
Gene Name Not Available
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus Not Available
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues 40
Molecular Weight 4336.0
Theoretical pI 6.62
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Glyceraldehyde-3-phosphate dehydrogenase
FNGTVKAENGKLVINGKAITIFQERDPANIKWGDAGAEYV
GenBank ID Protein AAZ32293.1
UniProtKB/Swiss-Prot ID Q2QJG6
UniProtKB/Swiss-Prot Entry Name Q2QJG6_BOVIN
PDB IDs
GenBank Gene ID DQ066892
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available