Showing Protein NAD(+)-dependent isocitrate dehydrogenase subunit 3 (BMDBP01096)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01096 |
| Secondary Accession Numbers | None |
| Name | NAD(+)-dependent isocitrate dehydrogenase subunit 3 |
| Synonyms | Not Available |
| Gene Name | IDH3 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 13 |
| Locus | Not Available |
| SNPs | IDH3 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 103 |
| Molecular Weight | 10927.0 |
| Theoretical pI | 8.95 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>NAD(+)-dependent isocitrate dehydrogenase subunit 3 MPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLS ASNMLRHLNLEHHSNMIAEAVKKVIKVGKVRTRDMGGYSTTTD |
| External Links | |
| GenBank ID Protein | AAG49483.1 |
| UniProtKB/Swiss-Prot ID | Q9BGH9 |
| UniProtKB/Swiss-Prot Entry Name | Q9BGH9_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AF307303 |
| GeneCard ID | IDH3 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |