Showing Protein NAD(+)-isocitrate dehydrogenase subunit 1 IDH1-C (BMDBP01101)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01101 |
| Secondary Accession Numbers | None |
| Name | NAD(+)-isocitrate dehydrogenase subunit 1 IDH1-C |
| Synonyms | Not Available |
| Gene Name | IDH |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | IDH |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 128 |
| Molecular Weight | 13766.0 |
| Theoretical pI | 8.86 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>NAD(+)-isocitrate dehydrogenase subunit 1 IDH1-C VQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGR NIANPTAMLLSASNMLRHLNLEHHSNMIAEAVKKVIKVGKVRTRDMGGYSTTTDFIRSVI GHLHPYGG |
| External Links | |
| GenBank ID Protein | AAC83168.1 |
| UniProtKB/Swiss-Prot ID | Q9TVD2 |
| UniProtKB/Swiss-Prot Entry Name | Q9TVD2_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AF090323 |
| GeneCard ID | IDH |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |