Showing Protein Glyceraldehyde 3-phosphate dehydrogenase (BMDBP01105)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01105 |
| Secondary Accession Numbers | None |
| Name | Glyceraldehyde 3-phosphate dehydrogenase |
| Synonyms | Not Available |
| Gene Name | G3PDH |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Carbohydrate transport and metabolism |
| Specific Function | Not Available |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 5 |
| Locus | Not Available |
| SNPs | G3PDH |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 93 |
| Molecular Weight | 10347.0 |
| Theoretical pI | 5.05 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Glyceraldehyde 3-phosphate dehydrogenase MAFRVPTPNVSVVDLTCRLEKPAKYDEIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDT HSSTFDAGAGIALNDHFVKLISWYDNEFGYSNR |
| External Links | |
| GenBank ID Protein | AAC34304.1 |
| UniProtKB/Swiss-Prot ID | O77679 |
| UniProtKB/Swiss-Prot Entry Name | O77679_BOVIN |
| PDB IDs | |
| GenBank Gene ID | AF077815 |
| GeneCard ID | G3PDH |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |