Showing Protein Vascular endothelial growth factor B (BMDBP01416)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01416 |
| Secondary Accession Numbers | None |
| Name | Vascular endothelial growth factor B |
| Synonyms | Not Available |
| Gene Name | VEGFB |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in growth factor activity |
| Specific Function | Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 29 |
| Locus | Not Available |
| SNPs | VEGFB |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 207 |
| Molecular Weight | 21655.0 |
| Theoretical pI | 8.02 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Vascular endothelial growth factor B MSPLLRRLLLAVLLQLAPAQAPVSQPDAPGHQKKVVSWIDVYARATCQPREVVVPLNMEL MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIQYPSSQLGEMSLEEHS QCECRPKKRESAVKPDRASTPHHRPQPRSVPGWDPAPGAPSPADITHPTPAPGPSAHAAP SAASALTPGPATAAADAAASSVVKGGA |
| External Links | |
| GenBank ID Protein | BAA77686.1 |
| UniProtKB/Swiss-Prot ID | Q9XS49 |
| UniProtKB/Swiss-Prot Entry Name | VEGFB_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AB004274 |
| GeneCard ID | VEGFB |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |