Showing Protein Cytochrome b (BMDBP01508)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01508 |
| Secondary Accession Numbers | None |
| Name | Cytochrome b |
| Synonyms | Not Available |
| Gene Name | CYTB |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Energy production and conversion |
| Specific Function | Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | CYTB |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 264 |
| Molecular Weight | 29427.0 |
| Theoretical pI | 7.23 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Cytochrome b GVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATL TRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLL ILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALA FSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLAS VLYFLLILVLMPTAGTIENKLLKW |
| External Links | |
| GenBank ID Protein | BAC20251.1 |
| UniProtKB/Swiss-Prot ID | Q8HCA8 |
| UniProtKB/Swiss-Prot Entry Name | Q8HCA8_BOVIN |
| PDB IDs | |
| GenBank Gene ID | AB090980 |
| GeneCard ID | CYTB |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |