Showing Protein Melatonin receptor type 1A (BMDBP01828)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01828 |
| Secondary Accession Numbers | None |
| Name | Melatonin receptor type 1A |
| Synonyms | Not Available |
| Gene Name | MTNR1A |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in melatonin receptor activity |
| Specific Function | High affinity receptor for melatonin. Likely to mediate the reproductive and circadian actions of melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 27 |
| Locus | Not Available |
| SNPs | MTNR1A |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 257 |
| Molecular Weight | 29370.0 |
| Theoretical pI | 9.36 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Melatonin receptor type 1A YPLALASIVNDGWSLSSLHCQLSGFLMGLSVIGSVFNITGIAINRYCCICHSLRYNKLYS STNSLCYVFLIWMLTLVAIVPNLCVGTLQYDPRIYSCTFTQSVSSAYTIAVVVFHFIVPM LVVIFCYLRIWALVLQVRWRVKPDNKPKLKPQDFRNFVTMFVVFVLFAICWAPLNFIGLV VASEPASMAPRIPEWLFVASYYMGYFNSCLNAIIYGLLNQNFRQEYRKIIVSLCTTKMFF VDSSNHVAHRIKRKPSP |
| External Links | |
| GenBank ID Protein | AAC48725.1 |
| UniProtKB/Swiss-Prot ID | O02769 |
| UniProtKB/Swiss-Prot Entry Name | MTR1A_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | U73327 |
| GeneCard ID | MTNR1A |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |