Showing Protein Thromboxane A2 receptor (BMDBP01892)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01892 |
| Secondary Accession Numbers | None |
| Name | Thromboxane A2 receptor |
| Synonyms | Not Available |
| Gene Name | TBXA2R |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in thromboxane receptor activity |
| Specific Function | Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C and adenylyl cyclase. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 7 |
| Locus | Not Available |
| SNPs | TBXA2R |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 343 |
| Molecular Weight | 37841.0 |
| Theoretical pI | 9.24 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Thromboxane A2 receptor MWPNASSLGPCFRPMNITLEERRLIASPWFAASFCLVGLASNLLALSVLMGARQGSSQSR SSFLTFLCGLVLTDFMGLLVTGAIVVTQHFVLFEWQAVDPGCSLCHFMGVIMVFFGLCPL LLGAAMASERFLGITRPFSRPATASQRRAWTTVGLVWASALALGLLPLLGVGHYTVQYPG SWCFLTLGTDPGDVAFGLLFALLGSISVGMSFLLNTISVATLCHVYHGQATAQQRPRDCE VEMMVQLMGIMVVASICWMPLLVFIAQTVLQSPPAMSPTGQLSRLTERQLLIYLRVATWN QILDPWVYILFRRAVIQRFYPRLSTRSRSLSLQPQLTRRSTIH |
| External Links | |
| GenBank ID Protein | AAC34309.1 |
| UniProtKB/Swiss-Prot ID | Q95125 |
| UniProtKB/Swiss-Prot Entry Name | TA2R_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | U53485 |
| GeneCard ID | TBXA2R |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |