Showing Protein Vitamin D3 receptor (BMDBP01912)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP01912 |
| Secondary Accession Numbers | None |
| Name | Vitamin D3 receptor |
| Synonyms | Not Available |
| Gene Name | VDR |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in sequence-specific DNA binding |
| Specific Function | Nuclear receptor for calcitriol, the active form of vitamin D3 which mediates the action of this vitamin on cells (By similarity). Enters the nucleus upon vitamin D3 binding where it forms heterodimers with the retinoid X receptor/RXR (By similarity). The VDR-RXR heterodimers bind to specific response elements on DNA and activate the transcription of vitamin D3-responsive target genes (By similarity). Plays a central role in calcium homeostasis (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | VDR |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 426 |
| Molecular Weight | 48318.0 |
| Theoretical pI | 5.95 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Vitamin D3 receptor MEATAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC PFNGDCRITKDNRRHCQACRLKRCIDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL RPKLSEEQQRIITTLLEAHHKTYDDTYSDFSQFRPPVRNSEDEGNRPLRSILTPSFSGNS SSSCSDHCTSSPDTMEPTSFSNQDLNEEDSDDPSVTLDLSQLSMLPHLADLVSYSIQKVI GFAKMIPGFRDLTPEDQIVLLKSSAIEVIMLRSNQSFTLDDDMSWTCGSPDYKYQVSDVT RAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALVEAIQDRLSN TLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPESSMKLTPLLFEV FGNEIS |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | Q28037 |
| UniProtKB/Swiss-Prot Entry Name | VDR_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | AAFC03056593 |
| GeneCard ID | VDR |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |