Showing Protein Acyl-CoA-binding protein (BMDBP02179)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02179 |
| Secondary Accession Numbers | None |
| Name | Acyl-CoA-binding protein |
| Synonyms | Not Available |
| Gene Name | DBI |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in acyl-CoA binding |
| Specific Function | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 2 |
| Locus | Not Available |
| SNPs | DBI |
| Gene Sequence |
>264 bp AATCTTTGCAACACCGCCGGCATGTCTCAGGCTGAGTTTGACAAAGCTGCTGAGGAAGTT AAGCATCTTAAGACCAAGCCAGCAGATGAGGAGATGCTGTTCATCTACAGCCACTACAAA CAAGCAACTGTGGGTGACATAAATACAGAACGTCCTGGAATGTTGGACTTCAAAGGCAAG GCCAAGTGGGATGCCTGGAATGAGCTGAAAGGGACTTCTAAAGAAGATGCCATGAAAGCT TACATTGACAAAGTAGAAGAACTA |
| Protein Properties | |
| Number of Residues | 87 |
| Molecular Weight | 10044.0 |
| Theoretical pI | 6.54 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Acyl-CoA-binding protein MSQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWN ELKGTSKEDAMKAYIDKVEELKKKYGI |
| External Links | |
| GenBank ID Protein | AAA30495.1 |
| UniProtKB/Swiss-Prot ID | P07107 |
| UniProtKB/Swiss-Prot Entry Name | ACBP_BOVIN |
| PDB IDs | |
| GenBank Gene ID | M15886 |
| GeneCard ID | DBI |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |