Showing Protein Nuclear transition protein 2 (BMDBP02536)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02536 |
| Secondary Accession Numbers | None |
| Name | Nuclear transition protein 2 |
| Synonyms | Not Available |
| Gene Name | Tnp2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in DNA binding |
| Specific Function | Plays a key role in the replacement of histones to protamine in the elongating spermatids of mammals. In condensing spermatids, loaded onto the nucleosomes, where it promotes the recruitment and processing of protamines, which are responsible for histone eviction. |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 25 |
| Locus | 25q12-q13 |
| SNPs | Tnp2 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 132 |
| Molecular Weight | 15241.0 |
| Theoretical pI | 12.4 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Nuclear transition protein 2 MDTKTQSLPNTHAQPHSNSRPQSHACHHCSCSQHCQSRSRSRSCRSRSSSRRPRSHRSPT GRQGQSPGPSPPLRRHRHTMHSHQCPSRPVTHSCSHSKNRKNLEGKVIKRKQVKRSKQVY KRKRQSSGRKYN |
| External Links | |
| GenBank ID Protein | DAA06276.1 |
| UniProtKB/Swiss-Prot ID | B3LF31 |
| UniProtKB/Swiss-Prot Entry Name | B3LF31_BOVIN |
| PDB IDs | Not Available |
| GenBank Gene ID | BK006514 |
| GeneCard ID | Tnp2 |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |