Identification
BMDB Protein ID BMDBP02536
Secondary Accession Numbers None
Name Nuclear transition protein 2
Synonyms Not Available
Gene Name Tnp2
Protein Type Enzyme
Biological Properties
General Function Involved in DNA binding
Specific Function Plays a key role in the replacement of histones to protamine in the elongating spermatids of mammals. In condensing spermatids, loaded onto the nucleosomes, where it promotes the recruitment and processing of protamines, which are responsible for histone eviction.
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 25
Locus 25q12-q13
SNPs Tnp2
Gene Sequence Not Available
Protein Properties
Number of Residues 132
Molecular Weight 15241.0
Theoretical pI 12.4
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Nuclear transition protein 2
MDTKTQSLPNTHAQPHSNSRPQSHACHHCSCSQHCQSRSRSRSCRSRSSSRRPRSHRSPT
GRQGQSPGPSPPLRRHRHTMHSHQCPSRPVTHSCSHSKNRKNLEGKVIKRKQVKRSKQVY
KRKRQSSGRKYN
GenBank ID Protein DAA06276.1
UniProtKB/Swiss-Prot ID B3LF31
UniProtKB/Swiss-Prot Entry Name B3LF31_BOVIN
PDB IDs Not Available
GenBank Gene ID BK006514
GeneCard ID Tnp2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available