Showing Protein Protein S100-B (BMDBP02623)
| Identification | |
|---|---|
| BMDB Protein ID | BMDBP02623 |
| Secondary Accession Numbers | None |
| Name | Protein S100-B |
| Synonyms | Not Available |
| Gene Name | S100B |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Involved in calcium ion binding |
| Specific Function | Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity (By similarity). |
| Pathways | Not Available |
| Reactions | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Gene Properties | |
| Chromosome Location | 1 |
| Locus | Not Available |
| SNPs | S100B |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 92 |
| Molecular Weight | 10668.0 |
| Theoretical pI | 4.25 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions | Not Available |
| Protein Sequence |
>Protein S100-B MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET LDSDGDGECDFQEFMAFVAMITTACHEFFEHE |
| External Links | |
| GenBank ID Protein | ABA39829.1 |
| UniProtKB/Swiss-Prot ID | P02638 |
| UniProtKB/Swiss-Prot Entry Name | S100B_BOVIN |
| PDB IDs | |
| GenBank Gene ID | DQ195377 |
| GeneCard ID | S100B |
| GenAtlas ID | Not Available |
| HGNC ID | Not Available |
| References | |
| General References | Not Available |