Identification
BMDB Protein ID BMDBP02623
Secondary Accession Numbers None
Name Protein S100-B
Synonyms Not Available
Gene Name S100B
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus Not Available
SNPs S100B
Gene Sequence Not Available
Protein Properties
Number of Residues 92
Molecular Weight 10668.0
Theoretical pI 4.25
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions Not Available
Protein Sequence
>Protein S100-B
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDSDGDGECDFQEFMAFVAMITTACHEFFEHE
GenBank ID Protein ABA39829.1
UniProtKB/Swiss-Prot ID P02638
UniProtKB/Swiss-Prot Entry Name S100B_BOVIN
PDB IDs
GenBank Gene ID DQ195377
GeneCard ID S100B
GenAtlas ID Not Available
HGNC ID Not Available
References
General References Not Available